Antibodies

View as table Download

Rabbit Polyclonal VAMP7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VAMP7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human VAMP7.

Rabbit Polyclonal Anti-VAMP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VAMP7 antibody: synthetic peptide directed towards the N terminal of human VAMP7. Synthetic peptide located within the following region: KIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKK