MAT2A mouse monoclonal antibody, clone AT3A2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
MAT2A mouse monoclonal antibody, clone AT3A2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
MAT2A mouse monoclonal antibody, clone AT3A2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Antibody against MAT2 alpha
Applications | WB |
Reactivities | Human, Rat, Bovine, Zebrafish, Monkey, Orang-Utan (Does not react with: Mouse) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an N terminal portion of the human protein (within residues 1-100). [Swiss-Prot# P31153] |
Rabbit Polyclonal Antibody against MAT1/2 alpha
Applications | WB |
Reactivities | Human, Rat, Bovine, Zebrafish, Orang-Utan, Monkey (Does not react with: Mouse) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human MAT2A protein (within residues 100-200). [Swiss-Prot# P31153] |
Rabbit Polyclonal Anti-MAT2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAT2A antibody: synthetic peptide directed towards the middle region of human MAT2A. Synthetic peptide located within the following region: LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK |