Antibodies

Jump to Filters
View as table Download
Selenophosphate synthetase 2 (SEPHS2) Rabbit Polyclonal Antibody
TA346766

USD 475.00

5 Days

Rabbit Polyclonal Anti-SEPHS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SEPHS2 antibody is: synthetic peptide directed towards the C-terminal region of Human SEPHS2. Synthetic peptide located within the following region: AATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAVSKASGRFGL
Selenophosphate synthetase 2 (SEPHS2) Rabbit Polyclonal Antibody
TA308431

USD 415.00

5 Days

Rabbit polyclonal antibody to SEPHS2 (selenophosphate synthetase 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 186 and 448 of SEPHS2 (Uniprot ID#Q99611)