Antibodies

Jump to Filters
View as table Download
BUD31 Rabbit Polyclonal Antibody
TA314832

USD 345.00

In Stock

Rabbit polyclonal anti-BUD31 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BUD31.
BUD31 Rabbit Polyclonal Antibody
TA343432

USD 375.00

5 Days

Rabbit Polyclonal Anti-BUD31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BUD31 antibody: synthetic peptide directed towards the N terminal of human BUD31. Synthetic peptide located within the following region: PKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFR
BUD31 Rabbit Polyclonal Antibody
TA343433

USD 310.00

5 Days

Rabbit Polyclonal Anti-BUD31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BUD31 antibody: synthetic peptide directed towards the middle region of human BUD31. Synthetic peptide located within the following region: SRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR