BUD31 Rabbit Polyclonal Antibody

CAT#: TA343432

Rabbit Polyclonal Anti-BUD31 Antibody

Product Images

WB Suggested Anti-BUD31 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BUD31 antibody: synthetic peptide directed towards the N terminal of human BUD31. Synthetic peptide located within the following region: PKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: BUD31 homolog
• Database Link:
  NP_003901
  Entrez Gene 8896 Human
  UniProt ID P41223
• Background: The exact function of BUD31 remains unknown.
• Synonyms: Cwc14; EDG-2; EDG2; fSAP17; G10; YCR063W
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 79%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Spliceosome