Antibodies

View as table Download

Goat Polyclonal Antibody against XAB2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SVPAAVFGSLKED, from the C Terminus of the protein sequence according to NP_064581.2.

Rabbit Polyclonal Anti-XAB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XAB2 antibody: synthetic peptide directed towards the N terminal of human XAB2. Synthetic peptide located within the following region: VKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKH

Rabbit Polyclonal Anti-XAB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XAB2 antibody: synthetic peptide directed towards the C terminal of human XAB2. Synthetic peptide located within the following region: KILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQS