Germany
Japan
United Kingdom
China
SMAD6 mouse monoclonal antibody, clone 4C8
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Antibodies
View as table Download
SMAD6 (285-385) mouse monoclonal antibody, clone 4F3, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-SMAD6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR |
Rabbit polyclonal SMAD6 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SMAD6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-386 amino acids from the Central region of human SMAD6. |
Rabbit Polyclonal Anti-SMAD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: GAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKE |
Rabbit Polyclonal SMAD6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Primate, Sheep |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against 2 synthetic peptides found between amino acids 30-150 and 300-400 of human SMAD6 (GenBank Accession No. AAH12986.1). These peptide sequences are specific to SMAD6, and have high homology to SMAD6 in multiple species. |
SMAD6 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-SMAD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMAD6 antibody is: synthetic peptide directed towards the N-terminal region of Human SMAD6. Synthetic peptide located within the following region: RRLWRSRVVPDREEGGSGGGGGGDEDGSLGSRAEPAPRAREGGGCGRSEV |
Active filters
Target Symbol
- SMAD6
Pathways
- TGF-beta signaling pathway