Antibodies

Jump to Filters
View as table Download
Claudin 15 (CLDN15) (Center) Rabbit Polyclonal Antibody
AP50942PU-N

USD 450.00

2 Weeks

Claudin 15 (CLDN15) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 135~165 amino acids from the Central region of human CLDN15
Claudin 15 (CLDN15) Rabbit Polyclonal Antibody
TA334207

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLDN15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the C terminal of human CLDN15. Synthetic peptide located within the following region: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
Claudin 15 (CLDN15) Rabbit Polyclonal Antibody
TA334208

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDN15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the middle region of human CLDN15. Synthetic peptide located within the following region: LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA