Antibodies

View as table Download

Rabbit Polyclonal Anti-ATP6V1B2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the middle region of human ATP6V1B2. Synthetic peptide located within the following region: NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK

Rabbit Polyclonal Anti-ATP6V1B2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the N terminal of human ATP6V1B2. Synthetic peptide located within the following region: VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG

Carrier-free (BSA/glycerol-free) ATP6V1B2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATP6V1B2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

ATP6V1B2 mouse monoclonal antibody,clone 1E11, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ATP6V1B2 mouse monoclonal antibody,clone 1E11, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ATP6V1B2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated