ATP6V1B2 Rabbit Polyclonal Antibody

CAT#: TA337651

Rabbit Polyclonal Anti-ATP6V1B2 Antibody

Product Images

WB Suggested Anti-ATP6V1B2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Hela cell lysate

• 

  WB Suggested Anti-ATP6V1B2 Antibody ; Positive Control: Lane 1: 80ug mouse brain extract; Primary Antibody Dilution : 1:500; Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR Bioscience; Secondry Antibody Dilution : 1:20,000; Submitted by: Dr

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the middle region of human ATP6V1B2. Synthetic peptide located within the following region: NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: ATPase H+ transporting V1 subunit B2
• Database Link:
  NP_001684
  Entrez Gene 11966 MouseEntrez Gene 526 Human
  UniProt ID P21281
• Background: ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: ATP6B1B2; ATP6B2; DOOD; HO57; VATB; Vma2; VPP3; ZLS2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection