ATP6V1B2 mouse monoclonal antibody, clone 2A5, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
ATP6V1B2 mouse monoclonal antibody, clone 2A5, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-ATP6V1B2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the middle region of human ATP6V1B2. Synthetic peptide located within the following region: NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK |
Rabbit Polyclonal Anti-ATP6V1B2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the N terminal of human ATP6V1B2. Synthetic peptide located within the following region: VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG |
Carrier-free (BSA/glycerol-free) ATP6V1B2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ATP6V1B2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 262-511 of human ATP6V1B2 (NP_001684.2). |
ATP6V1B2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 262-511 of human ATP6V1B2 (NP_001684.2). |
ATP6V1B2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 262-511 of human ATP6V1B2 (NP_001684.2). |
Modifications | Unmodified |
ATP6V1B2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
ATP6V1B2 mouse monoclonal antibody,clone 1E11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
ATP6V1B2 mouse monoclonal antibody,clone 1E11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ATP6V1B2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |