Goat Polyclonal Antibody against SFRP2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KRWQKGQREFKR, from the C Terminus of the protein sequence according to NP_003004.1. |
Goat Polyclonal Antibody against SFRP2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KRWQKGQREFKR, from the C Terminus of the protein sequence according to NP_003004.1. |
Rabbit polyclonal Anti-SFRP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SFRP2 antibody: synthetic peptide directed towards the middle region of human SFRP2. Synthetic peptide located within the following region: DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN |
Carrier-free (BSA/glycerol-free) SFRP2 mouse monoclonal antibody, clone OTI6E1 (formerly 6E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SFRP2 mouse monoclonal antibody, clone OTI6C2 (formerly 6C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SFRP2 mouse monoclonal antibody, clone OTI6E1 (formerly 6E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SFRP2 mouse monoclonal antibody, clone OTI6E1 (formerly 6E1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SFRP2 mouse monoclonal antibody, clone OTI6E1 (formerly 6E1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SFRP2 mouse monoclonal antibody, clone OTI6E1 (formerly 6E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SFRP2 mouse monoclonal antibody, clone OTI6C2 (formerly 6C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SFRP2 mouse monoclonal antibody, clone OTI6C2 (formerly 6C2), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SFRP2 mouse monoclonal antibody, clone OTI6C2 (formerly 6C2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SFRP2 mouse monoclonal antibody, clone OTI6C2 (formerly 6C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |