SFRP2 Rabbit Polyclonal Antibody

CAT#: TA342204

Rabbit polyclonal Anti-SFRP2 Antibody

Product Images

WB Suggested Anti-SFRP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SFRP2 antibody: synthetic peptide directed towards the middle region of human SFRP2. Synthetic peptide located within the following region: DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: secreted frizzled related protein 2
• Database Link:
  NP_003004
  Entrez Gene 6423 Human
  UniProt ID Q96HF1
• Background: This gene encodes a member ofThe SFRP family that contains a cysteine-rich domain homologous toThe putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation ofThis gene is a potential marker forThe presence of colorectal cancer. [provided by RefSeq, Jul 2008]
• Synonyms: FRP-2; SARP1; SDF-5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Wnt signaling pathway