Antibodies

Jump to Filters
View as table Download
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA332686

USD 374.00

3 Weeks

Rabbit anti-GLUL Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLUL
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
RA25062-100

USD 370.00

2 Weeks

Glutamine Synthetase (GLUL) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA323398

USD 345.00

4 Weeks

Anti-GLUL Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.365~369(G-D-E-P-F) derived from Human Glutamine Synthetase
Glutamine Synthetase (GLUL) (N-term) Rabbit Polyclonal Antibody
AP17428PU-N

USD 450.00

2 Weeks

Glutamine Synthetase (GLUL) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human GLUL
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA301447

USD 424.00

5 Days

Rabbit Polyclonal Antibody against Glutamine Synthase

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein.
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA342667

USD 375.00

5 Days

Rabbit Polyclonal Anti-GLUL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUL antibody: synthetic peptide directed towards the C terminal of human GLUL. Synthetic peptide located within the following region: TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: OTI1F4]
CF500700

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: OTI2C12]
CF814202

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GS mouse monoclonal antibody, clone OTI2C12

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA350024

USD 345.00

In Stock

Rabbit Polyclonal Anti-GLUL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GLUL
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: OTI1F4]
TA500700

USD 379.00

In Stock

GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F4]
TA500700AM

USD 420.00

4 Weeks

GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F4]
TA500700BM

USD 420.00

4 Weeks

GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: OTI1F4]
TA500700S

USD 159.00

In Stock

GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C12]
TA814202AM

USD 420.00

2 Weeks

GS mouse monoclonal antibody, clone OTI2C12, Biotinylated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Biotin
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C12]
TA814202BM

USD 420.00

2 Weeks

GS mouse monoclonal antibody, clone OTI2C12, HRP conjugated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation HRP
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: OTI2C12]
TA814202S

USD 159.00

2 Weeks

GS mouse monoclonal antibody, clone OTI2C12

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".