MCEE (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 135-164 amino acids from the C-terminal region of Human MCEE |
MCEE (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 135-164 amino acids from the C-terminal region of Human MCEE |
Rabbit Polyclonal Anti-MCEE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCEE antibody: synthetic peptide directed towards the C terminal of human MCEE. Synthetic peptide located within the following region: DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH |
Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI9E12 (formerly 9E12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI6A1 (formerly 6A1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI13B9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody,clone OTI3B11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI11G7 (formerly 11G7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MCEE mouse monoclonal antibody, clone OTI9E12 (formerly 9E12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MCEE mouse monoclonal antibody, clone OTI9E12 (formerly 9E12), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
MCEE mouse monoclonal antibody, clone OTI9E12 (formerly 9E12), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
MCEE mouse monoclonal antibody, clone OTI9E12 (formerly 9E12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MCEE mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MCEE mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MCEE mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MCEE mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MCEE mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MCEE mouse monoclonal antibody, clone OTI4A6 (formerly 4A6), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
MCEE mouse monoclonal antibody, clone OTI4A6 (formerly 4A6), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
MCEE mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MCEE mouse monoclonal antibody, clone OTI6A1 (formerly 6A1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MCEE mouse monoclonal antibody, clone OTI6A1 (formerly 6A1), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MCEE mouse monoclonal antibody, clone OTI6A1 (formerly 6A1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MCEE mouse monoclonal antibody, clone OTI6A1 (formerly 6A1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MCEE mouse monoclonal antibody,clone OTI13B9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MCEE mouse monoclonal antibody,clone OTI13B9, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
MCEE mouse monoclonal antibody,clone OTI13B9, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
MCEE mouse monoclonal antibody,clone OTI13B9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MCEE mouse monoclonal antibody,clone OTI3B11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MCEE mouse monoclonal antibody,clone OTI3B11, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MCEE mouse monoclonal antibody,clone OTI3B11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MCEE mouse monoclonal antibody,clone OTI3B11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MCEE mouse monoclonal antibody, clone OTI11G7 (formerly 11G7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MCEE mouse monoclonal antibody, clone OTI11G7 (formerly 11G7), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MCEE mouse monoclonal antibody, clone OTI11G7 (formerly 11G7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MCEE mouse monoclonal antibody, clone OTI11G7 (formerly 11G7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".