Antibodies

View as table Download

MCEE (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 135-164 amino acids from the C-terminal region of Human MCEE

Rabbit Polyclonal Anti-MCEE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCEE antibody: synthetic peptide directed towards the C terminal of human MCEE. Synthetic peptide located within the following region: DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH

Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI9E12 (formerly 9E12)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI6A1 (formerly 6A1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI13B9

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody,clone OTI3B11

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MCEE mouse monoclonal antibody, clone OTI11G7 (formerly 11G7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MCEE mouse monoclonal antibody, clone OTI9E12 (formerly 9E12)

Applications WB
Reactivities Human
Conjugation Unconjugated

MCEE mouse monoclonal antibody, clone OTI9E12 (formerly 9E12), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

MCEE mouse monoclonal antibody, clone OTI9E12 (formerly 9E12), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

MCEE mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MCEE mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

MCEE mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

MCEE mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MCEE mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)

Applications WB
Reactivities Human
Conjugation Unconjugated

MCEE mouse monoclonal antibody, clone OTI4A6 (formerly 4A6), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

MCEE mouse monoclonal antibody, clone OTI4A6 (formerly 4A6), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

MCEE mouse monoclonal antibody, clone OTI6A1 (formerly 6A1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MCEE mouse monoclonal antibody, clone OTI6A1 (formerly 6A1), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

MCEE mouse monoclonal antibody, clone OTI6A1 (formerly 6A1), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

MCEE mouse monoclonal antibody, clone OTI6A1 (formerly 6A1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MCEE mouse monoclonal antibody,clone OTI13B9

Applications WB
Reactivities Human
Conjugation Unconjugated

MCEE mouse monoclonal antibody,clone OTI13B9, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

MCEE mouse monoclonal antibody,clone OTI3B11

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MCEE mouse monoclonal antibody,clone OTI3B11

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MCEE mouse monoclonal antibody, clone OTI11G7 (formerly 11G7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MCEE mouse monoclonal antibody, clone OTI11G7 (formerly 11G7), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

MCEE mouse monoclonal antibody, clone OTI11G7 (formerly 11G7), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

MCEE mouse monoclonal antibody, clone OTI11G7 (formerly 11G7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".