Rabbit Polyclonal Anti-KIRREL2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KIRREL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human KIRREL2. |
Rabbit Polyclonal Anti-KIRREL2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KIRREL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human KIRREL2. |
Rabbit Polyclonal Anti-SESN2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SESN2 antibody: synthetic peptide directed towards the N terminal of human SESN2. Synthetic peptide located within the following region: LKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESL |
SESN2 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human Sestrin-2 |
Rabbit Polyclonal Anti-SESN2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SESN2 |
SESN2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |