Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal SSRP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSRP1 antibody: human SSRP1 (Structure-specific recognition protein 1), the GST tagged N-terminal part of the protein. |
SSRP1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 489-518 amino acids from the C-terminal region of Human SSRP1. |
Mouse Monoclonal anti-SSRP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-SSRP1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSRP1 antibody: synthetic peptide directed towards the middle region of human SSRP1. Synthetic peptide located within the following region: SSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMS |
Rabbit Polyclonal Anti-SSRP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSRP1 antibody: synthetic peptide directed towards the middle region of human SSRP1. Synthetic peptide located within the following region: MKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESF |
Rabbit Polyclonal Anti-SSRP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSRP1 antibody: synthetic peptide directed towards the N terminal of human SSRP1. Synthetic peptide located within the following region: MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTE |
SSRP1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human SSRP1 (NP_003137.1). |
| Modifications | Unmodified |
SSRP1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human SSRP1 (NP_003137.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SSRP1