Rabbit anti-BTG2 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Rabbit anti-BTG2 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Rabbit Polyclonal Anti-BTG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BTG2 Antibody: synthetic peptide directed towards the N terminal of human BTG2. Synthetic peptide located within the following region: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY |
Rabbit Polyclonal Anti-BTG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BTG2 Antibody: synthetic peptide directed towards the middle region of human BTG2. Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI7A10 (formerly 7A10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI9D3 (formerly 9D3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-BTG2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
BTG2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI7A10 (formerly 7A10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
BTG2 mouse monoclonal antibody, clone OTI7A10 (formerly 7A10), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI7A10 (formerly 7A10), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI7A10 (formerly 7A10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI9D3 (formerly 9D3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI9D3 (formerly 9D3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI9D3 (formerly 9D3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI9D3 (formerly 9D3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
BTG2 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |