BTG2 Rabbit Polyclonal Antibody

CAT#: TA333912

Rabbit Polyclonal Anti-BTG2 Antibody

Product Images

WB Suggested Anti-BTG2 Antibody Titration: 0.2-1 ug/ml; Positive Control: ACHN cell lysateBTG2 is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-BTG2 Antibody: synthetic peptide directed towards the N terminal of human BTG2. Synthetic peptide located within the following region: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: BTG family member 2
• Database Link:
  NP_006754
  Entrez Gene 7832 Human
  UniProt ID P78543
• Background: BTG2 is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: APRO1; PC3; TIS21
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 92%; Guinea pig: 92%; Mouse: 85%

Reference Data

• Protein Families: Transcription Factors