Rabbit Polyclonal Anti-SDF 1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
Rabbit Polyclonal Anti-SDF 1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
Rabbit Polyclonal CXCL12 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CXCL12 antibody was raised against a 16 amino acid peptide near the center of human CXCL12 |
Anti-Human SDF-1a Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human SDF-1α (CXCL12) |
Rabbit Polyclonal Anti-CXCL12 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCL12 antibody: synthetic peptide directed towards the middle region of human CXCL12. Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
Anti-CXCL12 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12 |
Anti-CXCL12 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12 |
CXCL12 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-89 of human CXCL12 (NP_954637.1). |
Modifications | Unmodified |
CXCL12 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CXCL12. |
SDF1 Rabbit polyclonal Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human SDF-1. AA range:44-93 |