Antibodies

View as table Download

Rabbit Polyclonal DBX1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DBX1 antibody was raised against a 15 amino acid synthetic peptide near the center of human DBX1.

Rabbit Polyclonal Anti-DBX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBX1 antibody: synthetic peptide directed towards the middle region of human DBX1. Synthetic peptide located within the following region: GGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDP

DBX1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DBX1