Antibodies

Jump to Filters
View as table Download
IL19 Rabbit Polyclonal Antibody
TA343359

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL19 antibody is: synthetic peptide directed towards the C-terminal region of Human IL19. Synthetic peptide located within the following region: KILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLE
IL19 Rabbit Polyclonal Antibody
TA351285

USD 345.00

In Stock

Rabbit Polyclonal Anti-IL19 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL19
IL19 Rabbit Polyclonal Antibody
TA358617

USD 360.00

5 Days

IL19 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
IL19 Rabbit Polyclonal Antibody
TA367096

USD 380.00

4 Weeks

IL19 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL19