Antibodies

View as table Download

Rabbit Polyclonal NTH1 Antibody

Applications WB
Reactivities Bovine, Human, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the human NTH1 conjugated to KLH.

Rabbit Polyclonal NTH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full-length recombinant protein.

Rabbit Polyclonal Anti-NTHL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NTHL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NTHL1. Synthetic peptide located within the following region: DWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS

NTHL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human NTHL1

NTHL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NTHL1

NTHL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human NTHL1 (NP_002519.1).
Modifications Unmodified

Rabbit Polyclonal anti-NTHL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NTHL1

Rabbit Polyclonal anti-NTHL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NTHL1