Rabbit Polyclonal POFUT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | POFUT1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human POFUT1. |
Rabbit Polyclonal POFUT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | POFUT1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human POFUT1. |
Rabbit polyclonal anti-POFUT1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POFUT1. |
Rabbit Polyclonal Anti-POFUT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POFUT1 antibody: synthetic peptide directed towards the middle region of human POFUT1. Synthetic peptide located within the following region: RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP |
POFUT1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human POFUT1 |
POFUT1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-194 of human POFUT1 (NP_758436.1). |
Modifications | Unmodified |