Rabbit polyclonal anti-TAF1A antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF1A. |
Rabbit polyclonal anti-TAF1A antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF1A. |
Rabbit Polyclonal Anti-TAF1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the C terminal of human TAF1A. Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL |
Rabbit Polyclonal Anti-TAF1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the N terminal of human TAF1A. Synthetic peptide located within the following region: CLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEI |
Carrier-free (BSA/glycerol-free) TAF1A mouse monoclonal antibody,clone OTI7A11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TAF1A mouse monoclonal antibody,clone OTI8C10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TAF1A mouse monoclonal antibody,clone OTI7A11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TAF1A mouse monoclonal antibody,clone OTI7A11, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TAF1A mouse monoclonal antibody,clone OTI7A11, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
TAF1A mouse monoclonal antibody,clone OTI7A11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TAF1A mouse monoclonal antibody,clone OTI8C10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TAF1A mouse monoclonal antibody,clone OTI8C10, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TAF1A mouse monoclonal antibody,clone OTI8C10, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
TAF1A mouse monoclonal antibody,clone OTI8C10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |