TAF1 48 (TAF1A) Rabbit Polyclonal Antibody

CAT#: TA330075

Rabbit Polyclonal Anti-TAF1A Antibody

Product Images

Host: Rabbit; Target Name: TAF (I)48; Sample Tissue: Raji Cell; Antibody Dilution: 1.0ug/ml; TAF1A is supported by BioGPS gene expression data to be expressed in Raji

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the N terminal of human TAF1A. Synthetic peptide located within the following region: CLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: TATA-box binding protein associated factor, RNA polymerase I subunit A
• Database Link:
  NP_005672
  Entrez Gene 9015 Human
  UniProt ID Q15573
• Background: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, also known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the smallest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.
• Synonyms: MGC:17061; RAFI48; SL1; TAFI48
• Note: Immunogen sequence homology: Human: 100%; Dog: 92%; Horse: 85%; Mouse: 85%; Rabbit: 85%; Pig: 78%; Rat: 78%

Reference Data

• Protein Families: Transcription Factors