Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 19 of 19 results

(reset)

USP13 Rabbit Polyclonal Antibody

TA312123

USD 345.00

In Stock

Rabbit polyclonal anti-USP13 antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human USP13.

1 / 2

2 / 2

Previous Next

USP13 Rabbit Polyclonal Antibody

TA342567

USD 375.00

5 Days

Rabbit Polyclonal Anti-USP13 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-USP13 antibody: synthetic peptide directed towards the N terminal of human USP13. Synthetic peptide located within the following region: TIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDNGVRIPPSGWK

USP13 Mouse Monoclonal Antibody [Clone ID: OTI4G11]

CF500318

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11)

Applications	IHC, IP, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

USP13 Mouse Monoclonal Antibody [Clone ID: OTI4G1]

CF500327

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

USP13 Mouse Monoclonal Antibody [Clone ID: OTI5B9]

CF500367

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications	IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

USP13 Rabbit Polyclonal Antibody

TA383144

USD 220.00

3 Weeks

USP13 Rabbit polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human USP13 (NP_003931.2).
Modifications	Unmodified

USP13 Rabbit Polyclonal Antibody

TA385532

USD 380.00

4 Weeks

USP13 Rabbit polyclonal Antibody

Applications	FC, IF, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A synthesized peptide derived from human USP13

USP13 Mouse Monoclonal Antibody [Clone ID: OTI4G11]

TA500318

USD 379.00

In Stock

Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11)

Applications	IHC, IP, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

USP13 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G11]

TA500318AM

USD 420.00

4 Weeks

Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11), Biotinylated

Applications	IHC, IP, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

USP13 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G11]

TA500318BM

USD 420.00

4 Weeks

Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11), HRP conjugated

Applications	IHC, IP, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

USP13 Mouse Monoclonal Antibody [Clone ID: OTI4G11]

TA500318S

USD 159.00

2 Days

Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11)

Applications	IHC, IP, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

USP13 Mouse Monoclonal Antibody [Clone ID: OTI4G1]

TA500327

USD 379.00

In Stock

Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

USP13 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G1]

TA500327AM

USD 420.00

4 Weeks

Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), Biotinylated

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

USP13 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G1]

TA500327BM

USD 420.00

4 Weeks

Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), HRP conjugated

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

USP13 Mouse Monoclonal Antibody [Clone ID: OTI4G1]

TA500327S

USD 159.00

2 Days

Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

USP13 Mouse Monoclonal Antibody [Clone ID: OTI5B9]

TA500367

USD 379.00

In Stock

Anti-USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications	IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

USP13 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B9]

TA500367AM

USD 420.00

4 Weeks

Anti-USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), Biotinylated

Applications	IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

USP13 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B9]

TA500367BM

USD 420.00

4 Weeks

Anti-USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), HRP conjugated

Applications	IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

USP13 Mouse Monoclonal Antibody [Clone ID: OTI5B9]

TA500367S

USD 159.00

2 Days

Anti-USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications	IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

1 - 19 of 19 results