Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ZNF165 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF165 antibody: synthetic peptide directed towards the middle region of human ZNF165. Synthetic peptide located within the following region: ISEASGESQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTV |
Rabbit Polyclonal Anti-ZNF165 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF165 antibody: synthetic peptide directed towards the middle region of human ZNF165. Synthetic peptide located within the following region: THQKSCKHGTCDQSFKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAA |
Carrier-free (BSA/glycerol-free) ZNF165 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF165 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
ZNF165 mouse monoclonal antibody,clone 4C1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF165 mouse monoclonal antibody,clone 4C1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF165 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- ZNF165
Reactivities
- Human