Antibodies

Jump to Filters
View as table Download
B3GALNT1 Rabbit Polyclonal Antibody
TA336005

USD 375.00

5 Days

Rabbit Polyclonal Anti-B3GALNT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B3GALNT1 Antibody: synthetic peptide directed towards the middle region of human B3GALNT1. Synthetic peptide located within the following region: PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
B3GALNT1 Rabbit Polyclonal Antibody
TA373888

USD 220.00

3 Weeks

B3GALNT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 44-331 of human B3GALNT1 (NP_003772.1).
Modifications Unmodified