BTBD6 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BTBD6 |
BTBD6 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BTBD6 |
Rabbit Polyclonal Anti-BTBD6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the N terminal of human BTBD6. Synthetic peptide located within the following region: FVVGPPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKSEIHIPDVEPAA |
Rabbit Polyclonal Anti-BTBD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the middle region of human BTBD6. Synthetic peptide located within the following region: GKAFNRCSHLTRHKKIHTAVKRYKCEECGKAFKRCSHLNEHKRVQRGEKS |
Rabbit polyclonal anti-BTBD6 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from interf human BTBD6. |
Rabbit Polyclonal Anti-BTBD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the middle region of human BTBD6. Synthetic peptide located within the following region: ALRSEGFCEIDRQTLEIIVTREALNTKEAVVFEAVLNWAEAECKRQGLPI |
BTBD6 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human BTBD6 |