Antibodies

View as table Download

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE

Rabbit polyclonal CDC25B (Ser323) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25B around the phosphorylation site of serine 323 (S-P-SP-M-P).
Modifications Phospho-specific

Rabbit Polyclonal CDC25B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B

Rabbit Polyclonal CDC25B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B

Rabbit Polyclonal CDC25B (Ser323) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 323
Modifications Phospho-specific

Rabbit Polyclonal CDC25B (Ser353) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 353
Modifications Phospho-specific

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS

Carrier-free (BSA/glycerol-free) CDC25B mouse monoclonal antibody,clone OTI11C5

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CDC25B mouse monoclonal antibody,clone OTI6H9

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC25B

CDC25B rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC25B

CDC25B Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human CDC25B (NP_068659.1).
Modifications Unmodified

CDC25B mouse monoclonal antibody,clone OTI11C5

Applications WB
Reactivities Human
Conjugation Unconjugated

CDC25B mouse monoclonal antibody,clone OTI11C5

Applications WB
Reactivities Human
Conjugation Unconjugated

CDC25B mouse monoclonal antibody,clone OTI6H9

Applications WB
Reactivities Human
Conjugation Unconjugated

CDC25B mouse monoclonal antibody,clone OTI6H9, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

CDC25B mouse monoclonal antibody,clone OTI6H9

Applications WB
Reactivities Human
Conjugation Unconjugated