Rabbit Polyclonal Anti-CLEC4F Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLEC4F Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC4F. Synthetic peptide located within the following region: LRGHLERAGDEIHVLKRDLKMVTAQTQKANGRLDQTDTQIQVFKSEMENV |
Rabbit Polyclonal Anti-CLEC4F Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLEC4F Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC4F. Synthetic peptide located within the following region: DSNLQKASAEIQRLRGDLENTKALTMEIQQEQSRLKTLHVVITSQEQLQR |
Germany
Japan
United Kingdom
China