Rabbit Polyclonal Anti-ECHDC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECHDC2 antibody: synthetic peptide directed towards the middle region of human ECHDC2. Synthetic peptide located within the following region: TQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQR |
Rabbit Polyclonal Anti-ECHDC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECHDC2 antibody: synthetic peptide directed towards the middle region of human ECHDC2. Synthetic peptide located within the following region: FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI |
Germany
Japan
United Kingdom
China