Antibodies

Jump to Filters
View as table Download
FAM172A Rabbit Polyclonal Antibody
TA332168

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM172A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM172A Antibody is: synthetic peptide directed towards the middle region of Human FAM172A. Synthetic peptide located within the following region: SSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENG