FAM172A Rabbit Polyclonal Antibody

CAT#: TA332168

Rabbit Polyclonal Anti-FAM172A Antibody

Product Images

Host: Rabbit; Target Name: FAM172A; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM172A Antibody is: synthetic peptide directed towards the middle region of Human FAM172A. Synthetic peptide located within the following region: SSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: family with sequence similarity 172 member A
• Database Link:
  NP_001156889
  Entrez Gene 83989 Human
  UniProt ID Q8WUF8
• Background: The function of this protein remains unknown.
• Synonyms: C5orf21
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Yeast: 83%