FAM20C rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FAM20C |
FAM20C rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FAM20C |
Rabbit Polyclonal Anti-FAM20C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FAM20C antibody: synthetic peptide directed towards the middle region of human FAM20C. Synthetic peptide located within the following region: CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY |
Rabbit Polyclonal Anti-FAM20C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FAM20C antibody: synthetic peptide directed towards the C terminal of human FAM20C. Synthetic peptide located within the following region: NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY |