Antibodies

View as table Download

Rabbit Polyclonal Anti-FXYD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FXYD1 antibody: synthetic peptide directed towards the N terminal of human FXYD1. Synthetic peptide located within the following region: ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILG

Rabbit Polyclonal Anti-FXYD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FXYD1

FXYD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FXYD1