Antibodies

View as table Download

5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-HTR7 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HTR7.

5HT7 Receptor (HTR7) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Anti-HTR7 / 5-HT7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QNADYCRKKGHDS, from the C Terminus of the protein sequence according to NP_000863.1.

Rabbit Polyclonal Anti-HTR7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI

Rabbit Polyclonal Anti-HTR7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI

Rabbit Polyclonal 5-HT7 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Canine
Conjugation Unconjugated
Immunogen This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 13-28 of the rat 5-HT7R (AAA42134.1).

Rabbit Polyclonal Anti-HTR7 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR7 / 5-HT7 Receptor antibody was raised against synthetic 14 amino acid peptide from N-terminus of human 5HT7 Receptor. Percent identity with other species by BLAST analysis: Human, Marmoset, Dog (100%).