Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-JAM3 antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This JAM3 antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 261-295 amino acids from the C-terminal region of human JAM3. |
Rabbit Polyclonal Anti-JAM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JAM3 antibody: synthetic peptide directed towards the N terminal of human JAM3. Synthetic peptide located within the following region: SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ |
JAM3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human JAM3 |
JAM3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human JAM3 (NP_116190.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- JAM3
Reactivities
- Human