Antibodies

View as table Download

Rabbit polyclonal Anti-KCNAB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV

Mouse Monoclonal anti-KCNA2B Antibody

Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated

Kcnab2 mouse monoclonal antibody, clone K17/70

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated

Kcnab2 mouse monoclonal antibody, clone K17/70

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated

Rabbit polyclonal Anti-KVbeta2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide SPGMIYSTRYGSPKR(C), corresponding to amino acid residues 20-34 of rat KvÃ?2 . N-terminal part.

Rabbit polyclonal Anti-KCNAB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV

Rabbit Polyclonal Anti-KCNAB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: SSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYSKKDYRS

Rabbit Polyclonal Anti-KCNAB2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the C terminal of human KCNAB2. Synthetic peptide located within the following region: KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL

KCNAB2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human KCNAB2

KCNAB2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2