Goat Anti-LPP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RNDSDPTYGQQGHP, from the internal region of the protein sequence according to NP_005569.1. |
Goat Anti-LPP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RNDSDPTYGQQGHP, from the internal region of the protein sequence according to NP_005569.1. |
Rabbit Polyclonal Anti-LPP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LPP Antibody: synthetic peptide directed towards the N terminal of human LPP. Synthetic peptide located within the following region: GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST |
Rabbit Polyclonal Anti-LPP rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LPP |
LPP rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LPP |
LPP (6F6) Mouse monoclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |