Rabbit Polyclonal MEIS1 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal MEIS1 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Goat Anti-MEIS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SEDITRSANLTDQ, from the internal region of the protein sequence according to NP_002389.1. |
Rabbit Polyclonal Anti-MEIS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MEIS1 antibody: synthetic peptide directed towards the middle region of human MEIS1. Synthetic peptide located within the following region: GKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGT |
Rabbit Polyclonal Anti-MEIS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MEIS1 Antibody: synthetic peptide directed towards the C terminal of human MEIS1. Synthetic peptide located within the following region: AVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM |
Carrier-free (BSA/glycerol-free) MEIS1 mouse monoclonal antibody,clone OTI3G8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MEIS1 mouse monoclonal antibody,clone OTI2A3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MEIS1 mouse monoclonal antibody,clone OTI3F12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MEIS1 mouse monoclonal antibody,clone OTI1B4
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MEIS1 mouse monoclonal antibody,clone OTI3H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MEIS1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MEIS1 |
MEIS1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MEIS1 |
MEIS1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human MEIS1. |
MEIS1 mouse monoclonal antibody,clone OTI3G8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MEIS1 mouse monoclonal antibody,clone OTI3G8, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MEIS1 mouse monoclonal antibody,clone OTI3G8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MEIS1 mouse monoclonal antibody,clone OTI3G8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MEIS1 mouse monoclonal antibody,clone OTI2A3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MEIS1 mouse monoclonal antibody,clone OTI2A3, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MEIS1 mouse monoclonal antibody,clone OTI2A3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MEIS1 mouse monoclonal antibody,clone OTI2A3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MEIS1 mouse monoclonal antibody,clone OTI3F12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MEIS1 mouse monoclonal antibody,clone OTI3F12, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
MEIS1 mouse monoclonal antibody,clone OTI3F12, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
MEIS1 mouse monoclonal antibody,clone OTI3F12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MEIS1 mouse monoclonal antibody,clone OTI1B4
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MEIS1 mouse monoclonal antibody,clone OTI1B4, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MEIS1 mouse monoclonal antibody,clone OTI1B4, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MEIS1 mouse monoclonal antibody,clone OTI1B4
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MEIS1 mouse monoclonal antibody,clone OTI3H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MEIS1 mouse monoclonal antibody,clone OTI3H2, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MEIS1 mouse monoclonal antibody,clone OTI3H2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MEIS1 mouse monoclonal antibody,clone OTI3H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |