Antibodies

View as table Download

Rabbit Polyclonal Anti-MMP28 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP28 antibody is: synthetic peptide directed towards the N-terminal region of Human MMP28. Synthetic peptide located within the following region: LDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWV

Rabbit anti MMP-28 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Anti-MMP28 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human matrix metallopeptidase 28

Anti-MMP28 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human matrix metallopeptidase 28

MMP28 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated