Antibodies

Jump to Filters
View as table Download
MRPS16 Rabbit Polyclonal Antibody
TA315438

USD 345.00

In Stock

Rabbit polyclonal anti-MRPS16 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MRPS16.
MRPS16 Rabbit Polyclonal Antibody
TA333784

USD 375.00

5 Days

Rabbit Polyclonal Anti-MRPS16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MRPS16 Antibody is: synthetic peptide directed towards the C-terminal region of Human MRPS16. Synthetic peptide located within the following region: EKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET
MRPS16 Rabbit Polyclonal Antibody
TA378670

USD 220.00

3 Weeks

MRPS16 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human MRPS16 (NP_057149.1).
Modifications Unmodified