Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against Npy2r
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KAKKNLEVKKNN, from the internal region of the protein sequence according to NP_032757.1. |
Rabbit Polyclonal anti-NPY2R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NPY2R antibody is: synthetic peptide directed towards the N-terminal region of Human NPY2R. Synthetic peptide located within the following region: PIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVV |
Anti-NPY2R Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 367-381 amino acids of human neuropeptide Y receptor Y2 |
NPY2R Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human NPY2R (NP_000901.1). |
Active filters
Target Symbol
- NPY2R
Reactivities
- Human