Antibodies

View as table Download

Rabbit Polyclonal Anti-FAM55D Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM55D Antibody: synthetic peptide directed towards the C terminal of human FAM55D. Synthetic peptide located within the following region: TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK

NXPE4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NXPE4