Antibodies

View as table Download

Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237)

Rabbit anti-PFKM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PFKM

Rabbit Polyclonal Anti-PFKM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKM antibody: synthetic peptide directed towards the C terminal of human PFKM. Synthetic peptide located within the following region: RALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHA

PFKM rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PFKM

PFKM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PFKM