Antibodies

Jump to Filters
View as table Download
PNRC2 Rabbit Polyclonal Antibody
TA344967

USD 475.00

5 Days

Rabbit Polyclonal Anti-PNRC2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNRC2 antibody: synthetic peptide directed towards the middle region of human PNRC2. Synthetic peptide located within the following region: NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN
PNRC2 Rabbit Polyclonal Antibody
TA366107

USD 380.00

4 Weeks

PNRC2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PNRC2
PNRC2 Rabbit Polyclonal Antibody
TA370462

USD 380.00

4 Weeks

PNRC2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PNRC2