Antibodies

Jump to Filters
View as table Download
RHOB Rabbit Polyclonal Antibody
TA313472

USD 345.00

In Stock

Rabbit polyclonal anti-RHOB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RHOB.
RHOB Rabbit Polyclonal Antibody
TA335065

USD 375.00

5 Days

Rabbit Polyclonal Anti-RHOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOB antibody: synthetic peptide directed towards the middle region of human RHOB. Synthetic peptide located within the following region: CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY
RHOB Rabbit Polyclonal Antibody
TA322808

USD 345.00

In Stock

Anti-RHOB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 179-188 amino acids of Human Ras homolog family member B
RHOB Rabbit Polyclonal Antibody
TA380914

USD 220.00

3 Weeks

RhoB Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RhoB (NP_004031.1).
Modifications Unmodified