Rabbit polyclonal anti-SENP5 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human SENP5. |
Rabbit polyclonal anti-SENP5 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human SENP5. |
Rabbit Polyclonal Anti-SENP5 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SENP5 Antibody: A synthesized peptide derived from human SENP5 |
Rabbit polyclonal Anti-SENP5 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SENP5 antibody: synthetic peptide directed towards the middle region of human SENP5. Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR |
Rabbit Polyclonal Anti-SENP5 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SENP5 |
SENP5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SENP5 |